PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G291100.1
Common NameB456_004G291100, LOC105792999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 662aa    MW: 72149.4 Da    PI: 5.781
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G291100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28207261155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ +LH++Fv av+qLG  ++A+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Gorai.004G291100.1 207 KPRVVWSVDLHRKFVAAVNQLGLGDQAVPKKILDLMNVEGLTRENVASHLQKYRL 261
                         79****************************************************8 PP

2Response_reg79.98.2e-27241321109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l+++l k +y +v+++ ++  al++l+ ++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  Gorai.004G291100.1  24 VLAVDDDPICLKILANLLCKCQY-QVTTTNQAIIALKMLRGNKnrYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKG 112
                         799********************.***************655556*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.004G291100.1 113 ITHGACDYLLKPVRIEELKN 132
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.8E-1652661IPR017053Response regulator B-type, plant
SuperFamilySSF521721.38E-3421144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.9E-4221145No hitNo description
SMARTSM004481.4E-3022134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.04423138IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.1E-2424132IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.68E-2725137No hitNo description
Gene3DG3DSA:3.40.50.23008.9E-42181187No hitNo description
PROSITE profilePS5129411.775204264IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-30204266IPR009057Homeodomain-like
SuperFamilySSF466892.51E-18205265IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-25207261IPR006447Myb domain, plants
PfamPF002493.6E-7209260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MEEKMGGSNG EDSGEDQFPV GMRVLAVDDD PICLKILANL LCKCQYQVTT TNQAIIALKM  60
LRGNKNRYDL VISDVNMPDM DGFKLLELVG LEMDLPVIML SAHSDTKLVM KGITHGACDY  120
LLKPVRIEEL KNIWQHVVRR KKPDSKDELA APNHDKSRGG TGEAGQTWVA CSSDQKVNKK  180
RKDQSEDEEE ETEDNGHENE DSSSQKKPRV VWSVDLHRKF VAAVNQLGLG DQAVPKKILD  240
LMNVEGLTRE NVASHLQKYR LYLRRLSSVA TQQANMVVAL GSRGPSHLRT GSLDGFGDFR  300
SFTGPRRFSS ASLPSYQSRG TFGRLNSSAA LTLSGISSGV IQPGNSVNGL GKIQPVVLPA  360
NQNQNEALFQ GITASIELNQ LSQTKSTNHF GEYNCVNERN VFRISSSFPD ARVVVGSSSN  420
SLSTASGNAL VLHGSTQEVQ CSAAFENLPS FGMTSLNRES NDLSVRGSFN CLEHGRCSEN  480
WQGTVQLSNF PPSNEQLPSN NLQESIPWRN SSPSNSRIAL SSMASSAVLG DSRADMLCKA  540
GLNNSYSHVD SRVSASGSMM DQNNAVSSNT NDVSLFSHLN GEAPFAVRHS EGDKSSSDTD  600
LRSNDNFLFL QSKPQNGFSQ NNFESLEDIM SPVFKLEQNN ETAFMDGGFG FDVAYPLGSC  660
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-23203267164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477357.10.0PREDICTED: two-component response regulator ARR12-like isoform X1
SwissprotB8AEH11e-128ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A0D2RCC50.0A0A0D2RCC5_G
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-116response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]